A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10006 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Melanotropin alpha 2 |
Mature Hormone Sequence | SYSMEHFRWGKPI |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (112-124) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10080 |
Swiss-prot Accession number | Q9PS30 (Sequence in FASTA format) |
Description | Gastrin-releasing peptide (GRP). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the bombesin/neuromedin-B/ranatensin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | GRP stimulates gastrin release as well as other gastrointestinal hormones |
Protein Length | 23 Amino acids |
Molecular weight | 2479 |
References | 1 PubMed abstract 1480521 |
Domain Name | N/A |
Hormone Name | Gastrin-releasing peptide |
Mature Hormone Sequence | SENTGAIGKVFPRGNHWAVGHLM |
Position of mature hormone in Pre-Hormone protein | 23 Residues from position (1-23) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10246 |
Swiss-prot Accession number | Q91971 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide 1 (GRPP 1); Glucagon-1; Glucagon-like peptide 1-1 (GLP 1-1); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 178 Amino acids |
Molecular weight | 20034 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-1 |
Mature Hormone Sequence | HSEGTFSNDYSKYQEERMAQDFVQWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (52-80) |
Receptor | N/A |
Gene ID | 100136745 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10247 |
Swiss-prot Accession number | Q91971 (Sequence in FASTA format) |
Description | Glucagon-1 precursor (Glucagon I) [Contains: Glicentin-relatedpolypeptide 1 (GRPP 1); Glucagon-1; Glucagon-like peptide 1-1 (GLP 1-1); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 178 Amino acids |
Molecular weight | 20034 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (137-169) |
Receptor | N/A |
Gene ID | 100136745 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10251 |
Swiss-prot Accession number | Q91189 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Promotes hydrolysis of glycogen and lipids, and raises the blood sugar level |
Protein Length | 178 Amino acids |
Molecular weight | 19998 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-2 |
Mature Hormone Sequence | QSEGTFSNYYSKYQEERMARDFLHWLMNS |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (52-80) |
Receptor | N/A |
Gene ID | 100136748 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10252 |
Swiss-prot Accession number | Q91189 (Sequence in FASTA format) |
Description | Glucagon-2 precursor (Glucagon II) [Contains: Glicentin-relatedpolypeptide 2 (GRPP 2); Glucagon-2; Glucagon-like peptide 1-2 (GLP 1-2); Glucagon-like peptide 2 (GLP 2)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 178 Amino acids |
Molecular weight | 19998 |
References | 1 PubMed abstract 7776976 |
Domain Name | Hormone_2 |
Hormone Name | Glucagon-like peptide 2 |
Mature Hormone Sequence | HVDGSFTSDVNKVLDSLAAKEYLLWVMTSKTSG |
Position of mature hormone in Pre-Hormone protein | 33 Residues from position (137-169) |
Receptor | N/A |
Gene ID | 100136748 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10302 |
Swiss-prot Accession number | P55246 (Sequence in FASTA format) |
Description | Progonadoliberin-3 precursor (Progonadoliberin III) [Contains:Gonadoliberin-3 (Gonadoliberin III) (Luteinizing hormone-releasinghormone III) (LH-RH III) (Gonadotropin-releasing hormone III) (GnRHIII) (Luliberin III); GnRH-associated peptide 3 (GnRH-associatedpeptide III)] (Fragment). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the GnRH family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates the secretion of gonadotropins |
Protein Length | 74 Amino acids |
Molecular weight | 8254 |
References | 1 Klungland H., Anderson O., Alestroem P.; "The salmon gonadotrophin-releasing hormone encoding gene insalmonids."; Mol. Mar. Biol. Biotechnol. 1:420-425(1992).
2 PubMed abstract 1308825 |
Domain Name | N/A |
Hormone Name | Gonadoliberin-3 |
Mature Hormone Sequence | QHWSYGWLPG |
Position of mature hormone in Pre-Hormone protein | 10 Residues from position (16-25) |
Receptor | Q9I986
Detail in HMRbase |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10309 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPVGRKRRPVKVYTNGVEEESSEAFPSEM |
Position of mature hormone in Pre-Hormone protein | 39 Residues from position (104-142) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10310 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin alpha 1 |
Mature Hormone Sequence | SYSMEHFRWGKPV |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (104-116) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10311 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | ELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPASKRYGGFMKSWDERSQKPLLTLFKNVIIKDGQQ |
Position of mature hormone in Pre-Hormone protein | 84 Residues from position (145-228) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10312 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Melanotropin beta 1 |
Mature Hormone Sequence | DGSYKMNHFRWSGPPAS |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (180-196) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10313 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Beta-endorphin 1 |
Mature Hormone Sequence | YGGFMKSWDERSQKPLLTLFKNVIIKDGQQ |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (199-228) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10314 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Met-enkephalin |
Mature Hormone Sequence | YGGFM |
Position of mature hormone in Pre-Hormone protein | 5 Residues from position (199-203) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10315 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Corticotropin |
Mature Hormone Sequence | SYSMEHFRWGKPIGHKRRPIKVYASSLEGGDSSEGTFPLQA |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (112-152) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10316 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Lipotropin beta (Beta-LPH) |
Mature Hormone Sequence | QLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAIKRYGGFMKPYTQQSHKPLITLLKHVTLKNEQ |
Position of mature hormone in Pre-Hormone protein | 86 Residues from position (155-240) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10317 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Lipotropin gamma (Gamma-LPH) |
Mature Hormone Sequence | QLSSWEDEMVGALGNQGAKAQTKVVPRTLTVTGLQDKKDGSYRMGHFRWGSPTAI |
Position of mature hormone in Pre-Hormone protein | 55 Residues from position (155-209) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10318 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Melanotropin beta 2 |
Mature Hormone Sequence | DGSYRMGHFRWGSPTAI |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (193-209) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10319 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Beta-endorphin 2 |
Mature Hormone Sequence | YGGFMKPYTQQSHKPLITLLKHVTLKNEQ |
Position of mature hormone in Pre-Hormone protein | 29 Residues from position (212-240) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10341 |
Swiss-prot Accession number | Q91194 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 115 Amino acids |
Molecular weight | 12963 |
References | 1 PubMed abstract 7628684 |
Domain Name | Somatostatin |
Hormone Name | [Tyr21,Gly24]-somatostatin-28 |
Mature Hormone Sequence | SVGNPNNLPPRERKAGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 28 Residues from position (88-115) |
Receptor | Q5G546 Detail in HMRbase Q5G547 Detail in HMRbase |
Gene ID | 100136751 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 10457 |
Swiss-prot Accession number | P33745 (Sequence in FASTA format) |
Description | Pro-MCH 1 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the melanin-concentrating hormone family. |
Tissue Specificity | Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released |
Post translational modification | N/A |
Function | N/A |
Protein Length | 132 Amino acids |
Molecular weight | 14608 |
References | 1 PubMed abstract 7731499 |
Domain Name | N/A |
Hormone Name | Neuropeptide-glutamic acid-valine |
Mature Hormone Sequence | EAGQDLSPSISIV |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (101-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10458 |
Swiss-prot Accession number | P33745 (Sequence in FASTA format) |
Description | Pro-MCH 1 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the melanin-concentrating hormone family. |
Tissue Specificity | Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released |
Post translational modification | N/A |
Function | Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH |
Protein Length | 132 Amino acids |
Molecular weight | 14608 |
References | 1 PubMed abstract 7731499 |
Domain Name | N/A |
Hormone Name | Melanin-concentrating hormone |
Mature Hormone Sequence | DTMRCMVGRVYRPCWEV |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (116-132) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10503 |
Swiss-prot Accession number | P69157 (Sequence in FASTA format) |
Description | Pro-MCH 2 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the melanin-concentrating hormone family. |
Tissue Specificity | Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released |
Post translational modification | N/A |
Function | N/A |
Protein Length | 132 Amino acids |
Molecular weight | 14710 |
References | 1 PubMed abstract 7731499 |
Domain Name | N/A |
Hormone Name | Neuropeptide-glutamic acid-valine |
Mature Hormone Sequence | EADQDLSPSISIV |
Position of mature hormone in Pre-Hormone protein | 13 Residues from position (101-113) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10504 |
Swiss-prot Accession number | P69157 (Sequence in FASTA format) |
Description | Pro-MCH 2 precursor [Contains: Neuropeptide-glutamic acid-valine (NEV)(Neuropeptide E-V); Melanin-concentrating hormone (MCH)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | Belongs to the melanin-concentrating hormone family. |
Tissue Specificity | Pituitary gland. Produced in neurons of lateral basal hypothalamus which project both to the brain and to the neural lobe of the pituitary gland from where MCH is released |
Post translational modification | N/A |
Function | Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH |
Protein Length | 132 Amino acids |
Molecular weight | 14710 |
References | 1 PubMed abstract 7731499 |
Domain Name | N/A |
Hormone Name | Melanin-concentrating hormone |
Mature Hormone Sequence | DTMRCMVGRVYRPCWEV |
Position of mature hormone in Pre-Hormone protein | 17 Residues from position (116-132) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10713 |
Swiss-prot Accession number | P09538 (Sequence in FASTA format) |
Description | Somatotropin 1 precursor (Growth hormone 1). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Protein Length | 210 Amino acids |
Molecular weight | 23795 |
References | 1 PubMed abstract 2908440 2 PubMed abstract 2647438 3 PubMed abstract 3545720 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin-1 (Somatotropin I) (Growth hormone I) |
Mature Hormone Sequence | IENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL |
Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
Receptor | N/A |
Gene ID | 100136733 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10717 |
Swiss-prot Accession number | P20332 (Sequence in FASTA format) |
Description | Somatotropin 2 precursor (Growth hormone 2). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Growth hormone plays an important role in growth control and is involved in the regulation of several anabolic processes. Implicated as an osmoregulatory substance important for seawater adaptation |
Protein Length | 210 Amino acids |
Molecular weight | 23946 |
References | 1 PubMed abstract 2908440 2 PubMed abstract 3393535 3 PubMed abstract 2647438 |
Domain Name | Hormone_1 |
Hormone Name | Somatotropin-2 (Somatotropin II) (Growth hormone II) |
Mature Hormone Sequence | MENQRLFNIAVNRVQHLHLLAQKMFNDFEGTLLPDERRQLNKIFLLDFCNSDSIVSPIDKQETQKSSVLKLLHISFRLIESWEYPSQTLTISNSLMVRNSNQISEKLSDLKVGINLLIKGSQDGVLSLDDNDSQHLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKYLEANCTL |
Position of mature hormone in Pre-Hormone protein | 188 Residues from position (23-210) |
Receptor | N/A |
Gene ID | 100136734 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10780 |
Swiss-prot Accession number | P37240 (Sequence in FASTA format) |
Description | Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the glycoprotein hormones subunit beta family. |
Tissue Specificity | Pituitary gland. Higher levels seen in immature fishes than the mature fishes |
Post translational modification | N/A |
Function | Indispensable for the control of thyroid structure and metabolism. May play some role in the biological processes of the immature fishes |
Protein Length | 147 Amino acids |
Molecular weight | 16440 |
References | 1 PubMed abstract 8327483 |
Domain Name | Cys_knot |
Hormone Name | Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain) |
Mature Hormone Sequence | MCVPTDYTLYEERRECDFCVAINTTICMGFCYSRDSNMKELAGPRFLIQRGCTYDQVEYRTVILPGCPLHANPLFTYPVALSCHCGTCNTDSDECAHKASSGDGARCSKPLRHIYPYPGLNSYIHPN |
Position of mature hormone in Pre-Hormone protein | 127 Residues from position (21-147) |
Receptor | N/A |
Gene ID | 100136289 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11023 |
Swiss-prot Accession number | P21993 (Sequence in FASTA format) |
Description | Prolactin precursor (PRL). |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatotropin/prolactin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 210 Amino acids |
Molecular weight | 23366 |
References | 1 PubMed abstract 2647439 |
Domain Name | Hormone_1 |
Hormone Name | Prolactin |
Mature Hormone Sequence | IGLSDLMERASQRSDKLHSLSTSLTKDLDSHFPPMGRVMMPRPSMCHTSSLQTPKDKEQALKVSENELISLARSLLLAWNDPLLLLSSEAPTLPHPSNGDISSKIRELQDYSKSLGDGLDIMVNKMGPSSQYISSIPFKGGDLGNDKTSRLINFHFLMSCFRRDSHKIDSFLKVLRCRATKMRPEAC |
Position of mature hormone in Pre-Hormone protein | 187 Residues from position (24-210) |
Receptor | N/A |
Gene ID | 100136792 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11051 |
Swiss-prot Accession number | P26351 (Sequence in FASTA format) |
Description | Thymosin beta-11. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 42 Amino acids |
Molecular weight | 4820 |
References | 1 Sakai M., Kono T.; "The cDNA sequence of rainbow trout thymosin beta."; Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases.
2 PubMed abstract 1575682 3 Echner H., Yialouris P.P., Haritos A.A., Gruebler G., Voelter W.; "Structure and syntheses of thymosin beta-11 and beta-12."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.751-752, Escom Science Publishers, Leiden (1993). |
Domain Name | Thymosin |
Hormone Name | Thymosin beta-11 |
Mature Hormone Sequence | SDKPNLEEVASFDKTKLKKTETQEKNPLPTKETIEQEKQAS |
Position of mature hormone in Pre-Hormone protein | 41 Residues from position (2-42) |
Receptor | N/A |
Gene ID | 100170202 |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11053 |
Swiss-prot Accession number | P26352 (Sequence in FASTA format) |
Description | Thymosin beta-12. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Cytoplasm |
Developmental Stage | N/A |
Similarity | Belongs to the thymosin beta family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization |
Protein Length | 43 Amino acids |
Molecular weight | 4891 |
References | 1 PubMed abstract 1575682 2 Echner H., Yialouris P.P., Haritos A.A., Gruebler G., Voelter W.; "Structure and syntheses of thymosin beta-11 and beta-12."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.751-752, Escom Science Publishers, Leiden (1993). |
Domain Name | Thymosin |
Hormone Name | Thymosin beta-12 |
Mature Hormone Sequence | SDKPDLAEVSNFDKTKLKKTETQEKNPLPTKETIEQEKQATA |
Position of mature hormone in Pre-Hormone protein | 42 Residues from position (2-43) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11233 |
Swiss-prot Accession number | O42241 (Sequence in FASTA format) |
Description | Progonadoliberin-2 precursor (Progonadoliberin II) [Contains:Gonadoliberin-2 (Gonadoliberin II) (Luteinizing hormone-releasinghormone II) (LH-RH II) (Gonadotropin-releasing hormone II) (GnRH-II)(Luliberin II); GnRH-associated peptide 2 (GnRH-associated peptideII)]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted protein |
Developmental Stage | N/A |
Similarity | Belongs to the GnRH family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Stimulates the secretion of gonadotropins |
Protein Length | 86 Amino acids |
Molecular weight | 9723 |
References | 1 Penlington M.C.; Submitted (SEP-1997) to the EMBL/GenBank/DDBJ databases.
|
Domain Name | N/A |
Hormone Name | Gonadoliberin-2 |
Mature Hormone Sequence | QHWSHGWYPG |
Position of mature hormone in Pre-Hormone protein | 10 Residues from position (25-34) |
Receptor | Q9I986
Detail in HMRbase |
Gene ID | 100135862 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11500 |
Swiss-prot Accession number | Q04617 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin A precursor (Pro-opiomelanocortin A) (POMC A)[Contains: NPP 1; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 1 (Alpha-MSH 1); Corticotropin-like intermediarypeptide 1 (CLIP-1); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 1 (Beta-MSH 1); Beta-endorphin 1; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | Expressed in sexually active or inactive fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals, and hypothalamus of triploid and ovulated female trout |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 253 Amino acids |
Molecular weight | 28559 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | NPP ACTH_domain Op_neuropeptide |
Hormone Name | Lipotropin gamma (Gamma-LPH) |
Mature Hormone Sequence | ELGTDDAVYPSLEAGTAEGGEAEGMEGVFSLQEKKDGSYKMNHFRWSGPPAS |
Position of mature hormone in Pre-Hormone protein | 52 Residues from position (145-196) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136771 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11501 |
Swiss-prot Accession number | Q04618 (Sequence in FASTA format) |
Description | Corticotropin-lipotropin B precursor (Pro-opiomelanocortin B) (POMC B)[Contains: NPP 2; Corticotropin (Adrenocorticotropic hormone) (ACTH);Melanotropin alpha 2 (Alpha-MSH 2); Corticotropin-like intermediarypeptide 2 (CLIP-2); Lipotropin beta (Beta-LPH); Lipotropin gamma(Gamma-LPH); Melanotropin beta 2 (Beta-MSH 2); Beta-endorphin 2; Met-enkephalin]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | Expressed only in sexually active fish. |
Similarity | Belongs to the POMC family. |
Tissue Specificity | Pituitary and hypothalamus of adult diploid animals |
Post translational modification | Specific enzymatic cleavages at paired basic residues yield the different active peptides. Acetylation of beta-endorphin occurs in a tissue-specific manner. |
Function | N/A |
Protein Length | 240 Amino acids |
Molecular weight | 26719 |
References | 1 PubMed abstract 1448114 2 PubMed abstract 1448114 |
Domain Name | ACTH_domain NPP Op_neuropeptide |
Hormone Name | Met-enkephalin |
Mature Hormone Sequence | YGGFM |
Position of mature hormone in Pre-Hormone protein | 5 Residues from position (212-216) |
Receptor | Q6QLQ0 Detail in HMRbase Q6QLQ1 Detail in HMRbase |
Gene ID | 100136772 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11507 |
Swiss-prot Accession number | Q91194 (Sequence in FASTA format) |
Description | Somatostatin-2 precursor (Somatostatin II) [Contains: [Tyr21,Gly24]-somatostatin-28; [Tyr7,Gly10]-somatostatin-14]. |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Oncorhynchus. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 115 Amino acids |
Molecular weight | 12963 |
References | 1 PubMed abstract 7628684 |
Domain Name | Somatostatin |
Hormone Name | [Tyr7,Gly10]-somatostatin-14 |
Mature Hormone Sequence | AGCKNFYWKGFTSC |
Position of mature hormone in Pre-Hormone protein | 14 Residues from position (102-115) |
Receptor | Q5G546 Detail in HMRbase Q5G547 Detail in HMRbase |
Gene ID | 100136751 |
PDB ID | N/A |
Drugpedia | wiki |
Comments |
HMRbase accession number | 11567 |
Swiss-prot Accession number | B0M1K7 (Sequence in FASTA format) |
Description | Leptin |
Source organism | Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei;Protacanthopterygii; Salmoniformes; Salmonidae; Salmoninae;Oncorhynchus. |
Subcellular location | N/A |
Developmental Stage | N/A |
Similarity | N/A |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | N/A |
Protein Length | 171 Amino acids |
Molecular weight | 18871 |
References | 1 PubMed abstract 18539064 |
Domain Name | N/A |
Hormone Name | Leptin |
Mature Hormone Sequence | |
Position of mature hormone in Pre-Hormone protein | |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |